From d9941cf663f6057ce10df4fdcf4dc4a0b7d55fe8 Mon Sep 17 00:00:00 2001
From: Malvika Sharan <malvika.sharan@embl.de>
Date: Wed, 9 Nov 2016 11:35:15 +0100
Subject: [PATCH] Update motif_visualization.md

---
 TeachingMaterials/motif_visualization.md | 6 +++---
 1 file changed, 3 insertions(+), 3 deletions(-)

diff --git a/TeachingMaterials/motif_visualization.md b/TeachingMaterials/motif_visualization.md
index ad2872d..1cbe2f7 100644
--- a/TeachingMaterials/motif_visualization.md
+++ b/TeachingMaterials/motif_visualization.md
@@ -31,10 +31,10 @@ NSSSYFAQLHAASGQNPPPSVHSSHKQPSKARSPNPLLSMR
 
 ## (Weblogo 3](http://weblogo.threeplusone.com/create.cgi)
 
-**About:**
+[**About**](http://weblogo.threeplusone.com/manual.html):
 
-`WebLogo is a web based application designed to make the generation of sequence logos as easy and painless as possible.
-A sequence logo is a graphical representation of an amino acid or nucleic acid multiple sequence alignment. Each logo consists of stacks of symbols, one stack for each position in the sequence. The overall height of the stack indicates the sequence conservation at that position, while the height of symbols within the stack indicates the relative frequency of each amino or nucleic acid at that position. The width of the stack is proportional to the fraction of valid symbols in that position. (Positions with many gaps have thin stacks.)In general, a sequence logo provides a richer and more precise description of, for example,a binding site, than would a consensus sequence.`
+"WebLogo is a web based application designed to make the generation of sequence logos as easy and painless as possible.
+A sequence logo is a graphical representation of an amino acid or nucleic acid multiple sequence alignment. Each logo consists of stacks of symbols, one stack for each position in the sequence. The overall height of the stack indicates the sequence conservation at that position, while the height of symbols within the stack indicates the relative frequency of each amino or nucleic acid at that position. The width of the stack is proportional to the fraction of valid symbols in that position. (Positions with many gaps have thin stacks.)In general, a sequence logo provides a richer and more precise description of, for example,a binding site, than would a consensus sequence."
 
 **When to use:**
 
-- 
GitLab