From e58e7707fb6eafa75f921389e06156dee0c3899e Mon Sep 17 00:00:00 2001 From: Malvika Sharan <malvika.sharan@embl.de> Date: Tue, 8 Nov 2016 16:01:00 +0100 Subject: [PATCH] Update EMBOSS_EBI.md --- TeachingMaterials/EMBOSS_EBI.md | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/TeachingMaterials/EMBOSS_EBI.md b/TeachingMaterials/EMBOSS_EBI.md index bcdb256..f9a0cd2 100644 --- a/TeachingMaterials/EMBOSS_EBI.md +++ b/TeachingMaterials/EMBOSS_EBI.md @@ -2,7 +2,7 @@ ###### Official [EMBOSS tutorial](http://emboss.sourceforge.net/docs/emboss_tutorial/emboss_tutorial.html) written by [Gary Williams](http://emboss.sourceforge.net/docs/emboss_tutorial/node8.html) -Why EMBOSS? +**Why EMBOSS?** - Open source - Wide range of tools for sequence analysis - Ideal for building workflow (commandline tools) @@ -37,7 +37,7 @@ Example proteins for dotmatcher: ### Set of P53 proteins: -Raw sequences +**Raw sequences** ``` >Mus musculus @@ -103,7 +103,7 @@ MNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCSELPPGSTKRALPTSTSSPSQPKKKPLDG EYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHTSHLKSKKGQSTSRHKKLMFKREGPDSD ``` -Aligned by Clustal Omega +**Aligned by Clustal Omega** ``` CLUSTAL O(1.2.3) multiple sequence alignment -- GitLab