Update tertiary_structure_pred.md

TeachingMaterials/tertiary_structure_pred.md

@@ -2,7 +2,20 @@
 
 ### Secondary structure prediction
 
+**Tool used in this course**: [JPred](http://www.compbio.dundee.ac.uk/jpred/)
 
+- Example using their default example protein
+- There is a limit of sequence length
+````
+MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGC
+````
+
+- Run Jpred (click the Make Prediction)
+- It immediately opens a list of PDB tht matches the query
+    - One can either explore those proteins individually using the PDB linkout
+    - Or, submit the job to identify a more accurate secondary structure assignment.
+    - the result page shows the predicted components of secondary structures
+    - ![Solution for jp_1Xqh2hJ](http://www.compbio.dundee.ac.uk/jpred4/results/jp_1Xqh2hJ/jp_1Xqh2hJ.results.html)
 
 ### Tertiary structure prediction