Update tertiary_structure_pred.md

TeachingMaterials/tertiary_structure_pred.md

@@ -139,7 +139,7 @@ Note the PhyreAlarm icon. This pops up in such cases of low confidence and cover
 
 ###### Exercise-3: investigate few more examples
 
-***Example using Human [Prion](http://www.uniprot.org/uniprot/P04156)***
+Example using Human [Prion](http://www.uniprot.org/uniprot/P04156)
 
 ````
 >sp|P04156|PRIO_HUMAN Major prion protein OS=Homo sapiens GN=PRNP PE=1 SV=1
@@ -149,7 +149,7 @@ MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGG
 Full html results of all homologues, models, secondary structure etc. available at:
 http://www.sbg.bio.ic.ac.uk/phyre2/phyre2_output/ecba3197e3730bcd/summary.html
 
-***Example using Human Toll like receptor***
+Example using [Human Toll like receptor1](http://www.uniprot.org/uniprot/Q15399)
 
 ````
 >sp|Q15399|TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens GN=TLR1 PE=1 SV=3