Update tertiary_structure_pred.md

TeachingMaterials/tertiary_structure_pred.md

@@ -120,11 +120,20 @@ Note the PhyreAlarm icon. This pops up in such cases of low confidence and cover
 MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG
 ````
 
-Full html results of all homologues, models, secondary structure and more available at:
+Full html results of all homologues, models, secondary structure etc. available at:
 http://www.sbg.bio.ic.ac.uk/phyre2/phyre2_output/ecba3197e3730bcd/summary.html
 
 ***Example using Human Toll like receptor***
 
+````
+>sp|Q15399|TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens GN=TLR1 PE=1 SV=3
+MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSLCSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKLTEQAKK
+````
+
+Full html results of all homologues, models, secondary structure etc. available at:
+http://www.sbg.bio.ic.ac.uk/phyre2/phyre2_output/6f4f568f92839199/summary.html
+
+
 ###### Example of intensive analysis: http://www.sbg.bio.ic.ac.uk/phyre2/phyre2_output/d4a1f7b1ec99b495/summary.html
 
 1.Click the Interactive 3D view in JSmol link. Maybe that N-terminal blue alpha-helix (which was built ab initio) probably shouldn't be where it is. It should probably pack better - but ab initio is tricky! Also there appears to be some tangling in the red C-terminus. This is usually caused by disagreements between the input templates in that region.
@@ -142,7 +151,7 @@ Intensive mode often creates excellent full length models that cannot be achieve
 
 **Other tools**:
 
-Example used: Human Toll like receptor 4
+Example: Human Toll like receptor 4
 
 ````
 >sp|O00206|TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens GN=TLR4 PE=1 SV=2
@@ -162,12 +171,16 @@ NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
 QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
 ````
 
+1. [I-TASSER](http://zhanglab.ccmb.med.umich.edu/I-TASSER/)
+
+Requires registration and submission permission
+Check an already analysed result page for [Toll like receptor 4](http://www.uniprot.org/uniprot/O00206) using I-TASSER
+
+Results available at: http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S298631/
+
 1. (PS)2-v2: [Protein Structure Prediction Server](http://ps2.life.nctu.edu.tw/docs.php)
-    - A much faster tool compared the Phyre2
+    - A much faster tool compared the Phyre2, unfortunately broken at the moment.
     - combines both sequence and secondary structure information for the detection of homologous proteins with remote similarity and the target-template alignment.
     - Check an already analysed result page for [Toll like receptor 4](http://www.uniprot.org/uniprot/O00206) using (PS)2-v2
 
-2. [I-TASSER](http://zhanglab.ccmb.med.umich.edu/I-TASSER/)
-
-Requires registration and submission permission
-Check an already analysed result page for [Toll like receptor 4](http://www.uniprot.org/uniprot/O00206) using I-TASSER
+Results available at: http://140.113.239.111/~ps2v2/display_multi.php?folder=408053421